PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400046183
Common NameLOC102598680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 539aa    MW: 59898.2 Da    PI: 8.4073
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400046183genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.46.1e-16741135
                  GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                          C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  PGSC0003DMP400046183  7 CYHCGVTSTPLWRNGPPEKPILCNACGSRWRTKGT 41
                          ****************66666***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004015.2E-10153IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.62E-11546No hitNo description
CDDcd002023.43E-16654No hitNo description
Gene3DG3DSA:3.30.50.103.3E-12741IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF003209.8E-14741IPR000679Zinc finger, GATA-type
PfamPF139192.6E-9282377IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPILCN ACGSRWRTKG TLANYTPLHA RPESDDLEEY  60
RVCRVKNMSL KNKEAKVLKQ KQNHDNTVVR TPPDYYQGFL KGLDEDTSNR SSSGSAISNT  120
ESSAQFGSTE ASDLTGPAQS NKWEAMVPSR KRTCISRSKH SSVEKLTKDL CTILHEQQSS  180
YFSGSSEEDL LFESDKPMVS VEIGHGSVLI RHPNSIGREE ESEGSSLSVN NKRRYVNEAY  240
SRLSTPPVNI NRGVNLPNLG TERTKKPNSQ GMEQHQIKRD KDHLEKLHIL GHHTSPLCHI  300
DLKDVLNYEE FVTHFTSDEQ KQLLKYLAPV DSFAPPDSLK NMFESSHFEE NLSSFQKLLA  360
EGVFDSSLSG VKIEDSRTLK RLILCYLTKS KWVEKYSLLK DTKCTSSTNG YEVTGGPNAI  420
GTGHSVNVKR PLEGHHPKYA GAKKAMKSPK RVVMKSSYEQ KELVDNNSSC FSLKCLFPLP  480
SNSSPVLDSF HVANDQDVLL DVPSNSSFAQ AELLRPTSNF AAQASTSSSS VYPHLVRP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361158.10.0PREDICTED: GATA transcription factor 26-like isoform X2
SwissprotQ8W4H11e-146GAT26_ARATH; GATA transcription factor 26
TrEMBLM1CIX10.0M1CIX1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000683480.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20892462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-149GATA transcription factor 26
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]